PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 237aa    MW: 26966.6 Da    PI: 7.3546
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604138.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.35.6e-32163220158
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  XP_009604138.1 163 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH 220
                     59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-33148221IPR003657WRKY domain
SuperFamilySSF1182903.79E-28155221IPR003657WRKY domain
PROSITE profilePS5081129.608158220IPR003657WRKY domain
SMARTSM007746.7E-37163222IPR003657WRKY domain
PfamPF031068.7E-25164220IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEGDHQERVL HNNYDLQVST FSTPHVNIHE MGFVHHFEDH QNQVMSFLTS PLSHSSQIPD  60
GAASTSAAPP TATCTTLAAG TNNGSSSLGF YHSELVNRSS WNNDQVETLD PKAIIDQNCS  120
GNASDGNNSW WRSSPSEKGK VKVRRKLREP RFCFQTRSDI DVLDDGYKWR KYGQKVVKNS  180
LHPRSYYRCT HSNCRVKKRV ERLSEDCRMV ITTYEGRHNH YPCDDSNSSE NDCFSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26154220874Probable WRKY transcription factor 4
2lex_A3e-26154220874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141147KVRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604138.10.0PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY42e-67WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0S3SVH61e-107A0A0S3SVH6_PHAAN; Uncharacterized protein
STRINGGLYMA07G13611.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA73362029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.15e-67WRKY family protein